Iright
BRAND / VENDOR: Proteintech

Proteintech, 27175-1-AP, Complement C2 Polyclonal antibody

CATALOG NUMBER: 27175-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Complement C2 (27175-1-AP) by Proteintech is a Polyclonal antibody targeting Complement C2 in WB, IHC, ELISA applications with reactivity to human samples 27175-1-AP targets Complement C2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, Raji cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Complement C2 (C2) is a key component of the classical and lectin pathways of the complement system. Complement C2 deficiency is associated with an increased susceptibility to infections, particularly those caused by encapsulated bacteria. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25690 Product name: Recombinant human C2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 587-726 aa of BC043484 Sequence: EANLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRSKVPPPR Predict reactive species Full Name: complement component 2 Observed Molecular Weight: 70 kDa, 80 kDa GenBank Accession Number: BC043484 Gene Symbol: C2 Gene ID (NCBI): 717 RRID: AB_2880787 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P06681 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924