Iright
BRAND / VENDOR: Proteintech

Proteintech, 27177-1-AP, WNT7A Polyclonal antibody

CATALOG NUMBER: 27177-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The WNT7A (27177-1-AP) by Proteintech is a Polyclonal antibody targeting WNT7A in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 27177-1-AP targets WNT7A in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse kidney tissue, rat kidney tissue Positive IP detected in: mouse kidney tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information WNT7A belongs to the Wnt family. WNT7A plays an important role in embryonic development, including dorsal versus ventral patterning during limb development, skeleton development and urogenital tract development (PMID: 16826533). WNT7A is required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation (PMID:30026314). WNT7A is highly expressed in basal cells and is secreted in abundance by basal cells (PMID: 36318668). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26060 Product name: Recombinant human WNT7A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-305 aa of BC008811 Sequence: DCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCD Predict reactive species Full Name: wingless-type MMTV integration site family, member 7A Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 30-39 kDa GenBank Accession Number: BC008811 Gene Symbol: WNT7A Gene ID (NCBI): 7476 RRID: AB_3085932 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00755 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924