Iright
BRAND / VENDOR: Proteintech

Proteintech, 27183-1-AP, SLC7A3 Polyclonal antibody

CATALOG NUMBER: 27183-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC7A3 (27183-1-AP) by Proteintech is a Polyclonal antibody targeting SLC7A3 in WB, ELISA applications with reactivity to human, mouse, rat samples 27183-1-AP targets SLC7A3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLC7A3 (solute carrier family 7 member 3), also called CAT-3, is a sodium-independent transporter selective for cationic amino acids, especially arginine. Highest mRNA levels are found in thymus, testis and placenta, with distinct expression in thalamus/hippocampus of adult brain. By governing intracellular arginine, SLC7A3 modulates nitric-oxide synthesis and mTOR signalling, processes critical for immunity, neurotransmission and vascular tone. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25494 Product name: Recombinant human SLC7A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 433-506 aa of BC033816 Sequence: DQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQIVYVCSSLLAVLLTALCLVLAQWSVPLLSGD Predict reactive species Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 3 Calculated Molecular Weight: 67 kDa Observed Molecular Weight: 62-70 kDa GenBank Accession Number: BC033816 Gene Symbol: SLC7A3 Gene ID (NCBI): 84889 RRID: AB_3665521 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WY07 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924