Proteintech, 27212-1-AP, TGFBR2 Polyclonal antibody

Size: 20ul / 150ul The TGFBR2 (27212-1-AP) by Proteintech is a Polyclonal antibody targeting TGFBR2 in WB, IHC, ELISA applications with reactivity to human samples 27212-1-AP targets TGFBR2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, COLO320 cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TGF beta Receptor II (TGFBR2) is a member of the transforming growth factor-β (TGF-β) superfamily, which are critical regulators of cell proliferation and differentiation, developmental patterning and morphogenesis, and disease pathogenesis (PMID: 10974075). TGFBR2 result in both SMAD4-dependent constraint of proliferation and SMAD4-independent activation of apoptosis (PMID: 29396446). The calculated molecular weight of TGFBR2 is 65 kDa. It has some isoforms with the molecular weight of 70-80 kDa and ~90 kDa after glycosylated. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25767 Product name: Recombinant human TGFBR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 23-166 aa of BC040499 Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ Predict reactive species Full Name: transforming growth factor, beta receptor II (70/80kDa) Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 65-80 kDa GenBank Accession Number: BC040499 Gene Symbol: TGFBR2 Gene ID (NCBI): 7048 RRID: AB_2918119 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P37173 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.