Iright
BRAND / VENDOR: Proteintech

Proteintech, 27215-1-AP, BAF53B Polyclonal antibody

CATALOG NUMBER: 27215-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BAF53B (27215-1-AP) by Proteintech is a Polyclonal antibody targeting BAF53B in WB, IHC, ELISA applications with reactivity to mouse, rat samples 27215-1-AP targets BAF53B in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BAF53B, also named as ACTL6B, encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. BAF53b is unique among nucleosome remodeling complex subunits because it is neuron specific and is not found in any other nucleosome remodeling complex besides the nBAF complex(PMID: 23525042). BAF53B can be detected as about 47-53 kDa. Specification Tested Reactivity: mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25745 Product name: Recombinant human ACTL6B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-82 aa of BC020944 Sequence: TVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM Predict reactive species Full Name: actin-like 6B Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 47-53 kDa GenBank Accession Number: BC020944 Gene Symbol: BAF53B Gene ID (NCBI): 51412 RRID: AB_2857952 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94805 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924