Proteintech, 27217-1-AP, USP40 Polyclonal antibody

Size: 20ul / 150ul The USP40 (27217-1-AP) by Proteintech is a Polyclonal antibody targeting USP40 in WB, IHC, ELISA applications with reactivity to human samples 27217-1-AP targets USP40 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, MCF-7 cells, PC-3 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information USP40 (ubiquitin specific peptidase 40), also known as ubiquitin thioesterase 40, deubiquitinating enzyme 40 or ubiquitin carboxyl-terminal hydrolase 40, is a 1235 amino acid protein that belongs to a large family of cysteine proteases that function as deubiquitinating enzymes. USP40 transcript is ubiquitously expressed but abundant in the kidney, heart, spleen, liver, and testis. Within the kidney, USP40 is expressed in glomerular endothelial cells during development (PMID:28148530). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25976 Product name: Recombinant human USP40 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1161-1235 aa of BC013305 Sequence: GDTIGVKNLLIDDDDDFSTIRDDTGKEKQKQRALGRRKSQEALHEQSSYILSSAETPARPRAPETSLSIHVGSFR Predict reactive species Full Name: ubiquitin specific peptidase 40 Observed Molecular Weight: 140 kDa GenBank Accession Number: BC013305 Gene Symbol: USP40 Gene ID (NCBI): 55230 RRID: AB_3085938 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.