Proteintech, 27218-1-AP, KIF2A Polyclonal antibody

Size: 20ul / 150ul The KIF2A (27218-1-AP) by Proteintech is a Polyclonal antibody targeting KIF2A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 27218-1-AP targets KIF2A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Kinesin Family Member 2A (KIF2A), also known as Kinesin-2, is a member of the kinesin-13 superfamily protein. KIF2A is a microtubule-depolymerizing kinesin motor protein with essential roles in neural progenitor division and axonal pruning during brain development. KIF2A is involved in microtubule depolymerization at minus ends of the spindle to generate pole-migration forces for chromosome movement. KIF2A is a crucial factor in the invasion and metastasis of various tumors, such as gastric cancer(PMID: 32801897), hepatocellular carcinoma(PMID: 36277155). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25692 Product name: Recombinant human KIF2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 528-679 aa of BC031828 Sequence: VDPTAAGDVRPIMHHPPNQIDDLETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVEDHRAVFQESIRWLEDEKALLEMTEEVDYDVDSYATQLEAILEQKIDILTELRDKVKSFRAALQEEEQASKQINPKRPRAL Predict reactive species Full Name: kinesin heavy chain member 2A Calculated Molecular Weight: 679 aa, 77 kDa Observed Molecular Weight: 80 kDa~100 kDa GenBank Accession Number: BC031828 Gene Symbol: KIF2A Gene ID (NCBI): 3796 RRID: AB_2880805 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00139 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.