Proteintech, 27219-1-AP, RAB5C Polyclonal antibody

Size: 20ul / 150ul The RAB5C (27219-1-AP) by Proteintech is a Polyclonal antibody targeting RAB5C in WB, ELISA applications with reactivity to human samples 27219-1-AP targets RAB5C in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, U-937 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25849 Product name: Recombinant human RAB5C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 138-216 aa of BC106039 Sequence: LASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN Predict reactive species Full Name: RAB5C, member RAS oncogene family Calculated Molecular Weight: 216 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC106039 Gene Symbol: RAB5C Gene ID (NCBI): 5878 RRID: AB_2880806 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P51148 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.