Proteintech, 27226-1-AP, FTO Polyclonal antibody

Size: 20ul / 150ul The FTO (27226-1-AP) by Proteintech is a Polyclonal antibody targeting FTO in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human samples 27226-1-AP targets FTO in WB, IHC, IF-P, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, MDA-MB-231 cells, Caco-2 cells, HEK-293 cells, HeLa cells, HEK-293T cells, SH-SY5Y cells Positive IHC detected in: human liver cancer tissue, human breast cancer tissue, human colon tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human lymphoma tissue, human liver cancer tissue Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Fat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in the FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, pig, monkey, chicken, hamster, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26095 Product name: Recombinant human FTO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-505 aa of NM_001080432 Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP Predict reactive species Full Name: fat mass and obesity associated Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: NM_001080432 Gene Symbol: FTO Gene ID (NCBI): 79068 RRID: AB_2880809 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9C0B1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.