Iright
BRAND / VENDOR: Proteintech

Proteintech, 27230-1-AP, SELENBP1 Polyclonal antibody

CATALOG NUMBER: 27230-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SELENBP1 (27230-1-AP) by Proteintech is a Polyclonal antibody targeting SELENBP1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 27230-1-AP targets SELENBP1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, A549 cells Positive IHC detected in: human liver tissue, human colon tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SELENBP1 (selenium binding protein 1,SBP1), also known as LPSB or SP56, is a 472 amino acid peripheral membrane protein that binds selenium covalently. Selenium, an essential trace element, has been shown to have an anti-cancer effect. Many reports have described a relationship between insufficient selenium intake and increased risk of cancer. Moreover, the expression of SELENBP1 has been shown to be decreased in several tumors including cancers of the prostate, lungs, colon, and ovary (PMID: 21143902, 20332323, 18272210). SELENBP1 has four isoforms with the molecular mass of 56kD, 52kD and 45kD. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20967 Product name: Recombinant human SELENBP1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-305 aa of BC009084 Sequence: MATKCGNCGPGYSTPLEAMKGPREEIVYLPCIYRNTGTEAPDYLATVDVDPKSPQYCQVIHRLPMPNLKDELHHSGWNTCSSCFGDSTKSRTKLVLPSLISSRIYVVDVGSEPRAPKLHKVIEPKDIHAKCELAFLHTSHCLASGEVMISSLGDVKGNGKGGFVLLDGETFEVKGTWERPGGAAPLGYDFWYQPRHNVMISTEWAAPNVLRDGFNPADVEAGLYGSHLYVWDWQRHEIVQTLSLKDGLIPLEIRFLHNPDAAQGFVGCALSSTIQRFYKNEGGTWSVEKVIQVPPKKVKGWLLPE Predict reactive species Full Name: selenium binding protein 1 Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 45 kDa, 52 kDa, 56 kDa GenBank Accession Number: BC009084 Gene Symbol: SELENBP1 Gene ID (NCBI): 8991 RRID: AB_2880811 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13228 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924