Iright
BRAND / VENDOR: Proteintech

Proteintech, 27231-1-AP, ALMS1 Polyclonal antibody

CATALOG NUMBER: 27231-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ALMS1 (27231-1-AP) by Proteintech is a Polyclonal antibody targeting ALMS1 in IF/ICC, ELISA applications with reactivity to human samples 27231-1-AP targets ALMS1 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ALMS1 (Alstrom syndrome protein 1) is also KIAA0328. ALMS1 encodes a ~ 0.5 megadalton protein that localises to the base of centrioles. Some studies have suggested a role for this protein in maintaining centriole-nucleated sensory organelles termed primary cilia, and AS is now considered to belong to the growing class of human genetic disorders linked to ciliary dysfunction (ciliopathies). The ALMS1 protein is a component of the centrosome (PMID:30421101). ALMS1 is involved in PCM1-dependent intracellular transport. ALMS1 is required, directly or indirectly, for the localization of NCAPD2 to the proximal ends of centrioles. It is required for proper formation and/or maintenance of primary cilia (PC), microtubule-based structures that protrude from the surface of epithelial cells. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26100 Product name: Recombinant human ALMS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2881-3000 aa of NM_015120 Sequence: LEQRELFEQSKAPRADDHVRKHHSPSPQHQDYVAPDLPSCIFLEQRELFEQCKAPYVDHQMRENHSPLPQGQDSIASDLPSPISLEQCQSKAPGVDDQMNKHHFPLPQGQDCVVEKNNQH Predict reactive species Full Name: Alstrom syndrome 1 Calculated Molecular Weight: 461 kDa GenBank Accession Number: NM_015120 Gene Symbol: ALMS1 Gene ID (NCBI): 7840 RRID: AB_2880812 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TCU4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924