Proteintech, 27245-1-AP, ECE1 Polyclonal antibody

Size: 20ul / 150ul The ECE1 (27245-1-AP) by Proteintech is a Polyclonal antibody targeting ECE1 in WB, ELISA applications with reactivity to human samples 27245-1-AP targets ECE1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HUVEC cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ECE1, Endothelin-converting enzyme 1, also known as ECE. It is located in cell membrane, and it has 4 isoforms. All isoforms are expressed in umbilical vein endothelial cells, polynuclear neutrophils, fibroblasts, atrium cardiomyocytes and ventricles. Isoforms A, B and C are also expressed in placenta, lung, heart, adrenal gland and phaeochromocytoma; isoforms A and C in liver, testis and small intestine; isoform B, C and D in endothelial cells and umbilical vein smooth muscle cells; isoforms C and D in saphenous vein cells, and isoform C in kidney (PMID: 9396733). The protein encoded by this gene is involved in proteolytic processing of endothelin precursors to biologically active peptides. Mutations in this gene are associated with Hirschsprung disease, cardiac defects and autonomic dysfunction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. The calculated molecular weight of ECE1 is 87 kDa, as a result of glycosylation, the apparent molecular mass of ECE1 is approximately 87-110 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26124 Product name: Recombinant human ECE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-189 aa of BC126257 Sequence: QYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNET Predict reactive species Full Name: endothelin converting enzyme 1 Observed Molecular Weight: 87-110 kDa GenBank Accession Number: BC126257 Gene Symbol: ECE1 Gene ID (NCBI): 1889 RRID: AB_3085941 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P42892 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.