Iright
BRAND / VENDOR: Proteintech

Proteintech, 27250-1-AP, DLEU7 Polyclonal antibody

CATALOG NUMBER: 27250-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The DLEU7 (27250-1-AP) by Proteintech is a Polyclonal antibody targeting DLEU7 in WB, ELISA applications with reactivity to human, mouse, rat samples 27250-1-AP targets DLEU7 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information DLEU7 (Deleted in Lymphocytic Leukemia 7) is a tumor suppressor protein, frequently inactivated in B-cell chronic lymphocytic leukemia (CLL). This 221-amino-acid protein functions as a critical negative regulator of NF-κB signaling by directly inhibiting TACI and BCMA, key transducers of B-cell proliferative signals. Through this mechanism, DLEU7 suppresses cell proliferation and induces apoptosis. DLEU7 represents a potential therapeutic target in CLL and other B-cell malignancies (PMID: 34277865; 35892027). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24414 Product name: Recombinant human DLEU7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC104892 Sequence: MASPAPLVASISHQMVALQTLQLLQQEWGWGDGPVAPGNPRDPDHVSTAPARRSGPPRARPGPGREERGGGVGTRSRRTAARVNSPEEEVV Predict reactive species Full Name: deleted in lymphocytic leukemia, 7 Calculated Molecular Weight: 221aa,24 kDa; 160aa,17 kDa Observed Molecular Weight: 17-24 kDa GenBank Accession Number: BC104892 Gene Symbol: DLEU7 Gene ID (NCBI): 220107 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UYE1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924