Iright
BRAND / VENDOR: Proteintech

Proteintech, 27251-1-AP, RBL2 Polyclonal antibody

CATALOG NUMBER: 27251-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RBL2 (27251-1-AP) by Proteintech is a Polyclonal antibody targeting RBL2 in WB, ELISA applications with reactivity to human samples 27251-1-AP targets RBL2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information RBL2, also named as Retinoblastoma-like protein 2 or p130, is a 1130 amino acid protein, which Belongs to the retinoblastoma protein (RB) family. RBL2 is a Key regulator of entry into cell division and is directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. RBL2 recruits and targets histone methyltransferases KMT5B and KMT5C, leading to epigenetic transcriptional repression and controls histone H4 'Lys-20' trimethylation. RBL2 probably acts as a transcription repressor by recruiting chromatin-modifying enzymes to promoters. RBL2 may act as a tumor suppressor. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25087 Product name: Recombinant human RBL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC034490 Sequence: MPSGGDQSPPPPPPPPAAAASDEEEEDDGEAEDAAPPAESPTPQIQQRFDELCSRLNMDEAARAEAWDSYRSMSESYTLEGNDLH Predict reactive species Full Name: retinoblastoma-like 2 (p130) Calculated Molecular Weight: 130 kDa Observed Molecular Weight: 128 kDa GenBank Accession Number: BC034490 Gene Symbol: RBL2 Gene ID (NCBI): 5934 RRID: AB_2880819 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q08999 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924