Proteintech, 27284-1-AP, JAK1 Polyclonal antibody

Size: 20ul / 150ul The JAK1 (27284-1-AP) by Proteintech is a Polyclonal antibody targeting JAK1 in WB, ELISA applications with reactivity to human, mouse, rat samples 27284-1-AP targets JAK1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Daudi cells, J774A.1 cells, RAW 264.7 cells, mouse lung tissue, rat lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Janus kinase 1(JAK1), is a member of a class of protein-tyrosine kinases (PTK) characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain. JAK1 is essential for signaling for certain type I and type II cytokines. JAK1 plays a critical role in initiating responses to multiple major cytokine receptor families. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25579 Product name: Recombinant human JAK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1080-1151 aa of BC132729 Sequence: SDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEA Predict reactive species Full Name: Janus kinase 1 (a protein tyrosine kinase) Calculated Molecular Weight: 1154 aa, 133 kDa Observed Molecular Weight: 125-133 kDa GenBank Accession Number: BC132729 Gene Symbol: JAK1 Gene ID (NCBI): 3716 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23458 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.