Proteintech, 27294-1-AP, FBXO31 Polyclonal antibody

Size: 20ul / 150ul The FBXO31 (27294-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO31 in WB, IHC, ELISA applications with reactivity to human, mouse samples 27294-1-AP targets FBXO31 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: mouse uterus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:600-1:2400 Background Information FBXO31, also known as F-box protein 31, is a substrate recognition protein of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex. It plays a crucial role in mediating the ubiquitination and subsequent degradation of target proteins through the ubiquitin-proteasome system. In pancreatic cancer, FBXO31 is upregulated and promotes cancer progression by targeting proteins like SIRT2 for degradation (PMID: 38216561). In endometrial cancer, FBXO31 acts as a tumor suppressor by regulating the ubiquitination of OGT (O-GlcNAc transferase), which affects cellular O-GlcNAcylation levels (PMID: 39894887). FBXO31 Is a reader of C-terminal amides, which ubiquitylates CTAPs for subsequent proteasomal degradation. A dominant de novo D334N mutation in FBXO31 alters FBXO31 substrate recognition and CTAP clearance, causing some important proteins to be degraded and clinical intellectual impairment or diplegic spastic cerebral (PMID: 39880951). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24867 Product name: Recombinant human FBXO31 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-178 aa of BC012748 Sequence: MYLPPHDPHVDDPMRFKPLFRIHLMERKAATVECMYGHKGPHHGHIQIVKKDEFSTKCNQTDHHRMSGGRQEEFRTWLREEWGRTLEDIFHEHMQELILMKFIYTSQYDNCLTYRRIYLPPSRPDDLIKPGLFKGTYGSHGLEIVMLSFHGRRARGTKITGDPNIPAGQQTVEIDLRH Predict reactive species Full Name: F-box protein 31 Observed Molecular Weight: 49 kDa, 60-70 kDa GenBank Accession Number: BC012748 Gene Symbol: FBXO31 Gene ID (NCBI): 79791 RRID: AB_2880833 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5XUX0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.