Iright
BRAND / VENDOR: Proteintech

Proteintech, 27301-1-AP, SLC22A13 Polyclonal antibody

CATALOG NUMBER: 27301-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC22A13 (27301-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A13 in WB, ELISA applications with reactivity to mouse, rat samples 27301-1-AP targets SLC22A13 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: unboiled mouse brain tissue, unboiled rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLC22A13 (solute carrier family 22 member 13), also known as OCTL1. It is expected to be located in cell membrane and mainly expressed in kidney. The calculated molecular weight of SLC22A13 is 60 kDa. This antibody can recognize the 52 kDa isoform of target. This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24072 Product name: Recombinant human SLC22A13 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-273 aa of BC035973 Sequence: MAQFVQVLAEIGDFGRFQIQLLILLCVLNFLSPFYFFAHVFMILDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLMFRPPPANASLQDILSHRFNETQPCDMGWEYPENRLPSLKNEFNLVCDRKHLKDTTQSVFMAGLLVGTLMFGPLCDRIGRKATILAQLLLFTLIGLATAFVPSFELYMALRFAVATAVAGLSFSNVTLLTEWVGPSWRTQAVVLAQCNFSLGQMVLAGLAYGFRNWRLLQITGTAPGLLLFFYFWALPE Predict reactive species Full Name: solute carrier family 22 (organic anion transporter), member 13 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 50-52, 60 kDa GenBank Accession Number: BC035973 Gene Symbol: SLC22A13 Gene ID (NCBI): 9390 RRID: AB_3085944 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y226 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924