Proteintech, 27303-1-AP, VAChT Polyclonal antibody

Size: 20ul / 150ul The VAChT (27303-1-AP) by Proteintech is a Polyclonal antibody targeting VAChT in WB, ELISA applications with reactivity to human, mouse, rat samples 27303-1-AP targets VAChT in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLC18A3 also known as VAChT, is the vesicular amine transporter family member. The SLC18A3 gene encodes a transmembrane protein that transports acetylcholine (ACh) into presynaptic secretory vesicles for release at cholinergic nerve endings in the central and peripheral nervous systems. Mutations in SLC18A3 are associated with congenital myasthenic syndrome(PMID: 27590285). The 68-70 kDa mature glycosylated form of VAChT can be detected (PMID: 14705140). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25153 Product name: Recombinant human SLC18A3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 410-501 aa of BC007765 Sequence: DVRHVSVYGSVYAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDVLLDEPPQGLYDAVRLRE Predict reactive species Full Name: solute carrier family 18 (vesicular acetylcholine), member 3 Calculated Molecular Weight: 532 aa, 57 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC007765 Gene Symbol: VAChT Gene ID (NCBI): 6572 RRID: AB_3669592 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16572 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.