Proteintech, 27306-1-AP, MMP-9 (Middle) Polyclonal antibody

Size: 20ul / 150ul The MMP-9 (Middle) (27306-1-AP) by Proteintech is a Polyclonal antibody targeting MMP-9 (Middle) in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 27306-1-AP targets MMP-9 (Middle) in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human saliva tissue Positive IP detected in: human saliva tissue Positive IHC detected in: human tonsillitis tissue, human lung cancer tissue, human spleen tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) (MMP9, synonyms: GELB, CLG4B) degrades collagens type IV and V. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa or 82 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26132 Product name: Recombinant human MMP9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 210-346 aa of BC006093 Sequence: WSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGEL Predict reactive species Full Name: matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase) Calculated Molecular Weight: 707 aa, 78 kDa Observed Molecular Weight: 92 kDa GenBank Accession Number: BC006093 Gene Symbol: MMP-9 Gene ID (NCBI): 4318 RRID: AB_2880837 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14780 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.