Proteintech, 27309-1-AP, Ki-67 Polyclonal antibody

Size: 20ul / 150ul The Ki-67 (27309-1-AP) by Proteintech is a Polyclonal antibody targeting Ki-67 in IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human samples 27309-1-AP targets Ki-67 in IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human colon cancer tissue, human gliomas tissue, human lung cancer tissue, human skin cancer tissue, human lymphoma tissue, human breast cancer tissue, Insulinoma tissue, K-562 cellsNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human lung cancer tissue Positive IF/ICC detected in: HeLa cells, HEK-293 cells Positive FC (Intra) detected in: Jurkat cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information The Ki-67 protein (also known as MKI67) is a cellular marker for proliferation. Ki67 is present during all active phases of the cell cycle (G1, S, G2 and M), but is absent in resting cells (G0). Cellular content of Ki-67 protein markedly increases during cell progression through S phase of the cell cycle. Therefore, the nuclear expression of Ki67 can be evaluated to assess tumor proliferation by immunohistochemistry. It has been demonstrated to be of prognostic value in breast cancer. In head and neck cancer, several studies have reported an association between high proliferative activity and poorer prognosis. Specification Tested Reactivity: human Cited Reactivity: human, pig, canine, zebrafish, hamster, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26266 Product name: Recombinant human KI67 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1201-1300 aa of NM_002417 Sequence: AGTLPGSKRQLQTPKEKAQALEDLAGFKELFQTPGHTEELVAAGKTTKIPCDSPQSDPVDTPTSTKQRPKRSIRKADVEGELLACRNLMPSAGKAMHTPK Predict reactive species Full Name: antigen identified by monoclonal antibody Ki-67 Calculated Molecular Weight: 359 kDa GenBank Accession Number: NM_002417 Gene Symbol: KI67 Gene ID (NCBI): 4288 RRID: AB_2756525 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46013 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.