Iright
BRAND / VENDOR: Proteintech

Proteintech, 27331-1-AP, Inhibin alpha Polyclonal antibody

CATALOG NUMBER: 27331-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Inhibin alpha (27331-1-AP) by Proteintech is a Polyclonal antibody targeting Inhibin alpha in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27331-1-AP targets Inhibin alpha in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse ovary tissue, mouse testis tissue, rat ovary tissue Positive IHC detected in: mouse ovary tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Background Information Inhibin, a heterodimeric member of the TGF family, consists of an alpha (α) subunit (coded by INHA) and a beta (β) subunit, which combine to produce either inhibin A (αβA) or inhibin B (αβB). Inhibin complexes negatively regulate follicle stimulating hormone secretion from the pituitary gland. Inhibins have also been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25999 Product name: Recombinant human INHA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 233-366 aa of BC006391 Sequence: STPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI Predict reactive species Full Name: inhibin, alpha Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC006391 Gene Symbol: Inhibin alpha Gene ID (NCBI): 3623 RRID: AB_3085946 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05111 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924