Product Description
Size: 20ul / 150ul
The MRPL35 (27339-1-AP) by Proteintech is a Polyclonal antibody targeting MRPL35 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples
27339-1-AP targets MRPL35 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse heart tissue, mouse liver tissue
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:12000
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
Mitochondrial ribosomal protein L35 (MRPL35) is a member of the large subunit family of mitochondrial ribosomal proteins. It plays a key role in the assembly of cytochrome C oxidase, involved in the translation of mitochondrial proteins.
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag26300 Product name: Recombinant human MRPL35 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-170 aa of BC020651 Sequence: TTSERNLTCGHTSVILNRMAPVLPSVLKLPVRSLTYFSARKGKRKTVKAVIDRFLRLHCGLWVRRKAGYKKKLWKKTPARKKRLREFVFCNKTQSKLLDKMTTSFWKRRN Predict reactive species
Full Name: mitochondrial ribosomal protein L35
Calculated Molecular Weight: 170 aa, 19 kDa
Observed Molecular Weight: 24 kDa
GenBank Accession Number: BC020651
Gene Symbol: MRPL35
Gene ID (NCBI): 51318
RRID: AB_3669593
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NZE8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924