Proteintech, 27346-1-AP, NSD1 Polyclonal antibody

Size: 20ul / 150ul The NSD1 (27346-1-AP) by Proteintech is a Polyclonal antibody targeting NSD1 in WB, ELISA applications with reactivity to human samples 27346-1-AP targets NSD1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information NSD1 (nuclear receptor SET (su(var)3-9, enhancer-of-zeste,trithorax) domain containing protein-1), which is isolated and characterized in 2001, belongs to the NSD protein lysine methyltransferase (KMT) family. This family has three members, NSD1 (KMT3B), NSD2 (WHSC1/MMSET) and NSD3 (WHSC1L1), which could regulate the expression of target genes through methylation of lysine 36 on histone H3(H3K36). NSD1 could bind various promoter elements to regulate transcription via interactions with H3K36 methylation and RNA polymerase II. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26425 Product name: Recombinant human NSD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 341-630 aa of BC150628 Sequence: QRSLVCGSKVKLCYIGAGDEEKRSDSISICTTSDDGSSDLDPIEHSSESDNSVLEIPDAFDRTENMLSMQKNEKIKYSRFAATNTRVKAKQKPLISNSHTDHLMGCTKSAEPGTETPQVNLSDLKASTLVHKPQSDFTNDALSPKFNLSSSISSENSLIKGGAANQALLHSKSKQPKFRSIKCKHKENPVMAEPPVINEECSLKCCSSDTKGSPLASISKSGKVDGLKLLNNMHEKTRDSSDIETAVVKHVLSELKELSYRSLGEDVSDSGTSKPSKPLLFSSASSQNHI Predict reactive species Full Name: nuclear receptor binding SET domain protein 1 Observed Molecular Weight: 267-310 kDa GenBank Accession Number: BC150628 Gene Symbol: NSD1 Gene ID (NCBI): 64324 RRID: AB_3085948 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96L73 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.