Iright
BRAND / VENDOR: Proteintech

Proteintech, 27348-1-AP, IL-1R1 Polyclonal antibody

CATALOG NUMBER: 27348-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The IL-1R1 (27348-1-AP) by Proteintech is a Polyclonal antibody targeting IL-1R1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 27348-1-AP targets IL-1R1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, MOLT-4 cells, Raji cells, EL-4-B5 cells, NIH/3T3 cells, mouse liver tissue Positive IHC detected in: mouse spleen tissue, human appendicitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information IL-1R1 (IL-1 receptor type 1, also known as p80, IL-1R-alpha or CD121a) is a 80 kDa transmembrane glycoprotein and a member of the interleukin-1 receptor family (PMID: 35163653; 29248002). It is a receptor for IL-1α, IL-1β, and interleukin-1 receptor antagonist (IL-1Ra). IL-1α and IL-1β interact with the extracellular domain of IL-1R1, triggering the recruitment of an accessory receptor, the IL-1RAcP, resulting in a functional receptor complex that initiates IL-1R1 signaling cascades (PMID: 35163653). IL-1Ra competes with active IL-1 and blocks binding to their common activating receptor IL-1R1 and, thus, inhibits IL-1 signaling (PMID: 35332327; 11641511). It has been reported that IL-1R1 may also bind IL-38 (PMID: 29248002). IL-1R1 expression has been found in many cell types including T cells, macrophages, neutrophils, eosinophils, basophils, mast cells, fibroblasts, and endothelial cells. IL-1R1 can be released from the cell surface following proteolytic cleavage, generating a soluble form of 55-60 kDa (PMID: 17324958). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25998 Product name: Recombinant human IL-1R1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-336 aa of BC075063 Sequence: LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK Predict reactive species Full Name: interleukin 1 receptor, type I Calculated Molecular Weight: 569 aa, 65 kDa Observed Molecular Weight: 80 kDa, 60 kDa GenBank Accession Number: BC075063 Gene Symbol: IL1R1 Gene ID (NCBI): 3554 RRID: AB_3085949 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P14778 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924