Iright
BRAND / VENDOR: Proteintech

Proteintech, 27359-1-AP, SEMA4A Polyclonal antibody

CATALOG NUMBER: 27359-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SEMA4A (27359-1-AP) by Proteintech is a Polyclonal antibody targeting SEMA4A in WB, IHC, ELISA applications with reactivity to human samples 27359-1-AP targets SEMA4A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells Positive IHC detected in: human breast cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Sema4A, the membrane-bound class 4 semaphorin, belongs to semaphorins superfamily. Sema4A funtions as potent axonal repellants in the nervous system, and is involved in vascular development. Two species of Sema4A with molecular weights of about 150 and 120 kDa were observed. The antibody recognizes the Sema4A protein, which is of appropriate molecular size (~120 kDa) for the glycosylated protein(PMID: 26296689/17318185/26024919). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26023 Product name: Recombinant human SEMA4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 96-330 aa of BC020974 Sequence: RLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLVSYNVTHLYTCGTFAFSPACTFIELQDSYLLPISEDKVMEGKGQSPFDPAHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDNFLRWLHHDASFVAAIPSTQVVYFFFEETASEFDFFERLHTSRVARVCKNDVGGEKLLQKKWTTFLKAQLLCTQPGQLPFNVIRHAVLLPADSPTAPHIYAVFTSQWQV Predict reactive species Full Name: sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A Calculated Molecular Weight: 761 aa, 84 kDa Observed Molecular Weight: 120-150 kDa GenBank Accession Number: BC020974 Gene Symbol: SEMA4A Gene ID (NCBI): 64218 RRID: AB_2880854 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3S1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924