Proteintech, 27384-1-AP, DVL1 Polyclonal antibody

Size: 20ul / 150ul The DVL1 (27384-1-AP) by Proteintech is a Polyclonal antibody targeting DVL1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 27384-1-AP targets DVL1 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, NIH/3T3 cells, mouse cerebellum tissue, HEK-293 cells, MDA-MB-231 cells Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information DVL1 is one of three DVL homologous proteins (DVL1-3) widely expressed in embryonic development and in the adult central nervous system. Dishevelled proteins are a necessary component of the Wnt and planar cell polarity developmental signaling pathways. Overexpression of DVL1 has been linked to prostate and breast cancers through the Wnt signaling pathway. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26055 Product name: Recombinant human DVL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 283-416 aa of BC050454 Sequence: LGQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRELA Predict reactive species Full Name: dishevelled, dsh homolog 1 (Drosophila) Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 75 kDa, 73 kDa GenBank Accession Number: BC050454 Gene Symbol: DVL1 Gene ID (NCBI): 1855 RRID: AB_2880859 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14640 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.