Proteintech, 27391-1-AP, PPAP2B Polyclonal antibody

Size: 20ul / 150ul The PPAP2B (27391-1-AP) by Proteintech is a Polyclonal antibody targeting PPAP2B in WB, ELISA applications with reactivity to human, mouse samples 27391-1-AP targets PPAP2B in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: U-87 MG cells, human placenta tissue, mouse cerebellum tissue, mouse lung tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Phosphatidic acid phosphatase type 2B (PPAP2B), also known as Lipid phosphate phosphatase 3 (LPP3), is a member of the phosphatidic acid phosphatase (PAP) family. PPAP2B is an integral membrane protein that inactivates lysophosphatidic acid, was implicated in coronary artery disease (CAD) by genomewide association studies (PMID: 26034042). PPAP2B can be detected at least two immunoreactive bands with different mobility, ranging from 36 to 50 kDa, which may reflect oligomer formation and/or post-translational protein modifications, such as glycosylation (PMID: 28364255). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26422 Product name: Recombinant human PPAP2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC009196 Sequence: MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQN Predict reactive species Full Name: phosphatidic acid phosphatase type 2B Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 30-40 kDa GenBank Accession Number: BC009196 Gene Symbol: PPAP2B Gene ID (NCBI): 8613 RRID: AB_3669598 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14495 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.