Iright
BRAND / VENDOR: Proteintech

Proteintech, 27410-1-AP, CNTNAP3 Polyclonal antibody

CATALOG NUMBER: 27410-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CNTNAP3 (27410-1-AP) by Proteintech is a Polyclonal antibody targeting CNTNAP3 in WB, ELISA applications with reactivity to human samples 27410-1-AP targets CNTNAP3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CNTNAP3 belongs to the Neurexin superfamily and is a member of the Contactin-Associated Protein (CNTNAP) family, which also includes well-studied members like CNTNAP2. CNTNAP3 is predominantly expressed in the central nervous system (CNS), including regions such as the cerebral cortex, hippocampus, and cerebellum. Its expression is primarily in neurons. Compared to its family member CNTNAP2, CNTNAP3 expression begins later in development and persists into adulthood, suggesting roles in both developmental processes and the maintenance of mature neural circuits. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26624 Product name: Recombinant human CNTNAP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 625-695 aa of BC132737 Sequence: TDAAWTVVQHGGPDAVTLRGAPSGHPRSAVSFAYAAGAGQLRSAVNLAERCEQRLALRCGTARRPDSRDGT Predict reactive species Full Name: contactin associated protein-like 3 Observed Molecular Weight: 124 kDa GenBank Accession Number: BC132737 Gene Symbol: CNTNAP3 Gene ID (NCBI): 79937 RRID: AB_2880864 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BZ76 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924