Proteintech, 27415-1-AP, THEMIS Polyclonal antibody

Size: 20ul / 150ul The THEMIS (27415-1-AP) by Proteintech is a Polyclonal antibody targeting THEMIS in WB, IHC, ELISA applications with reactivity to human, mouse samples 27415-1-AP targets THEMIS in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells Positive IHC detected in: human tonsillitis tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The T cell lineage-restricted protein THEMIS, also called C6orf190 and C6orf207, plays a critical role in T cell development at the positive selection stage (PMID: 37159521). THEMIS plays a central role in late thymocyte development by controlling both positive and negative T-cell selection. It is required to sustain and/or integrate signals required for proper lineage commitment and maturation of T-cells and regulates T-cell development through T-cell antigen receptor (TCR) signaling (PMID: 28697966, 28250424). It can also promote the proliferative response of CD8+ T cells to low-affinity ligands (PMID: 31932808). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26387 Product name: Recombinant human TSEPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-222 aa of BC130516 Sequence: AEICEQIEGCESLQPFELPMNFPGLFKIVADKTPYLTMEEITRTIHIGPSRLGHPCFYHQKDIKLENLIIKQGEQIMLNSVEEIDGEIMVSCAVARNHQTHSFNLPLSQEGEFYECEDERIYTLKEIVEWKIPKNRTRTVNLTDFSNKWDSTNPFPKDFYGT Predict reactive species Full Name: thymocyte selection pathway associated Observed Molecular Weight: 70 kDa GenBank Accession Number: BC130516 Gene Symbol: THEMIS Gene ID (NCBI): 387357 RRID: AB_2880866 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N1K5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.