Proteintech, 27435-1-AP, RAB34 Polyclonal antibody

Size: 20ul / 150ul The RAB34 (27435-1-AP) by Proteintech is a Polyclonal antibody targeting RAB34 in WB, IHC, ELISA applications with reactivity to human samples 27435-1-AP targets RAB34 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, HeLa cells, U2OS cells, A549 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RAB34, a Rab protein family member, is involved in repositioning of lysosomes, activation of micropinocytosis, and protein transport. RAB34 is aberrantly expressed in various cancers and exhibits oncogenic properties. Recently, Rab34 is identified as a ciliary protein. Rab34 is required for internal assembly of cilia but not for cilia built on the cell surface. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26696 Product name: Recombinant human RAB34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-251 aa of BC016841 Sequence: QAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP Predict reactive species Full Name: RAB34, member RAS oncogene family Calculated Molecular Weight: 251 aa, 28 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC016841 Gene Symbol: RAB34 Gene ID (NCBI): 83871 RRID: AB_2880870 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BZG1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.