Iright
BRAND / VENDOR: Proteintech

Proteintech, 27437-1-AP, NKAP Polyclonal antibody

CATALOG NUMBER: 27437-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The NKAP (27437-1-AP) by Proteintech is a Polyclonal antibody targeting NKAP in WB, ELISA applications with reactivity to human samples 27437-1-AP targets NKAP in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information NKAP is a multifunctional nuclear protein that is involved in the activation of the ubiquitous transcription factor NF-kappaB. NKAP is associated with the the histone deacetylase HDAC3 and with the Notch corepressor complex, and it thereby acts as a transcriptional repressor of Notch target genes. It is also required for alphabeta T cell development. A related pseudogene has been identified on chromosome X, while a related and intronless retrocopy, which has an intact CDS and may be functional, is located on chromosome 6. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26637 Product name: Recombinant human NKAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC015354 Sequence: MAPVSGSRSPDREASGSGGRRRSSSKSPKPSKSARSPRGRRSRSHSCSRSGDRNGLTHQLGGLSQGSRNQSYRSRSRSRSRERPSAPRGIPFASASSSVYYGSYSRPYGSDKPWPSLLDKER Predict reactive species Full Name: NFKB activating protein Calculated Molecular Weight: 415 aa, 47 kDa Observed Molecular Weight: 47-50 kDa GenBank Accession Number: BC015354 Gene Symbol: NKAP Gene ID (NCBI): 79576 RRID: AB_3085959 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5F7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924