Proteintech, 27444-1-AP, SGK196 Polyclonal antibody

Size: 20ul / 150ul The SGK196 (27444-1-AP) by Proteintech is a Polyclonal antibody targeting SGK196 in WB, ELISA applications with reactivity to human, mouse, rat samples 27444-1-AP targets SGK196 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, SH-SY5Y cells, U-251 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SGK196, also known as POMK (protein O-mannose kinase), is an enzyme that plays a significant role in multiple biological processes. As a type II transmembrane protein, SGK196 consists of a cytoplasmic tail, one transmembrane helix, and a luminal domain (PMID: 31913260). It is widely expressed in tissues such as skeletal muscle, brain, heart, and kidney. SGK196 has been identified as a valuable marker for melanoma and has been found to suppress the metastasis of basal-like breast cancer cells, suggesting its role in tumorigenesis and cell survival. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24922 Product name: Recombinant human SGK196 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 201-350 aa of BC101548 Sequence: VMCDSNDLPKTLSQYLLTSNFSILANDLDALPLVNHSSGMLVKCGHRELHGDFVAPEQLWPYGEDVPFHDDLMPSYDEKIDIWKIPDISSFLLGHIEGSDMVRFHLFDIHKACKSQTPSERPTAQDVLETYQKVLDTLRDAMMSQAREML Predict reactive species Full Name: protein kinase-like protein SgK196 Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC101548 Gene Symbol: SGK196 Gene ID (NCBI): 84197 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H5K3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.