Proteintech, 27446-1-AP, SH3BP5L Polyclonal antibody

Size: 20ul / 150ul The SH3BP5L (27446-1-AP) by Proteintech is a Polyclonal antibody targeting SH3BP5L in WB, IHC, ELISA applications with reactivity to human samples 27446-1-AP targets SH3BP5L in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: 769-P cells, PC-3 cells, RKO cells, THP-1 cells Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SH3BP5L (SH3 Binding Domain Protein 5 Like) is a protein-coding gene that encodes a protein with a conserved N-terminus and functions as a guanine nucleotide exchange factor (GEF) for Rab11 GTPases. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23990 Product name: Recombinant human SH3BP5L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-393 aa of BC017254 Sequence: QFSQILEEHKAKVTELEQQVAQAKTRYSVALRNLEQISEQIHARRRGGLPPHPLGPRRSSPVGAEAGPEDMEDGDSGIEGAEGAGLEEGSSLGPGPAPDTDTLSLLSLRTVASDLQKCDSVEHLRGLSDHVSLDGQELGTRSGGRRGSDGGARGGRHQRSVSL Predict reactive species Full Name: SH3-binding domain protein 5-like Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC017254 Gene Symbol: SH3BP5L Gene ID (NCBI): 80851 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L8J4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.