Product Description
Size: 20ul / 150ul
The ABCA3 (27450-1-AP) by Proteintech is a Polyclonal antibody targeting ABCA3 in WB, IHC, ELISA applications with reactivity to human, rat samples
27450-1-AP targets ABCA3 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.
Tested Applications
Positive WB detected in: unboiled rat lung tissue
Positive IHC detected in: mouse cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Background Information
ABCA3 belongs to the ATP-binding cassette (ABC) transporter superfamily. ABCA3, which is expressed in alveolar type II pneumocytes and localizes predominantly to the limiting membrane of lamellar bodies, is critical for synthesis of surfactant(PMID: 17267394). Mutation of the ABCA3 gene causes fatal surfactant deficiency in newborns(PMID: 15044640).
Specification
Tested Reactivity: human, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24749 Product name: Recombinant human ABCA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1606-1704 aa of BC140895 Sequence: GSGYSLRAKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR Predict reactive species
Full Name: ATP-binding cassette, sub-family A (ABC1), member 3
Observed Molecular Weight: 140-160 kDa
GenBank Accession Number: BC140895
Gene Symbol: ABCA3
Gene ID (NCBI): 21
RRID: AB_3669603
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q99758
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924