Proteintech, 27450-1-AP, ABCA3 Polyclonal antibody

Size: 20ul / 150ul The ABCA3 (27450-1-AP) by Proteintech is a Polyclonal antibody targeting ABCA3 in WB, IHC, ELISA applications with reactivity to human, rat samples 27450-1-AP targets ABCA3 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: unboiled rat lung tissue Positive IHC detected in: mouse cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information ABCA3 belongs to the ATP-binding cassette (ABC) transporter superfamily. ABCA3, which is expressed in alveolar type II pneumocytes and localizes predominantly to the limiting membrane of lamellar bodies, is critical for synthesis of surfactant(PMID: 17267394). Mutation of the ABCA3 gene causes fatal surfactant deficiency in newborns(PMID: 15044640). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24749 Product name: Recombinant human ABCA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1606-1704 aa of BC140895 Sequence: GSGYSLRAKVQSEGQQEALEEFKAFVDLTFPGSVLEDEHQGMVHYHLPGRDLSWAKVFGILEKAKEKYGVDDYSVSQISLEQVFLSFAHLQPPTAEEGR Predict reactive species Full Name: ATP-binding cassette, sub-family A (ABC1), member 3 Observed Molecular Weight: 140-160 kDa GenBank Accession Number: BC140895 Gene Symbol: ABCA3 Gene ID (NCBI): 21 RRID: AB_3669603 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99758 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.