Proteintech, 27453-1-AP, CACNA2D1 Polyclonal antibody

Size: 20ul / 150ul CACNA2D1 Polyclonal Antibody for WB, IHC, IF-P, ELISA 27453-1-AP targets CACNA2D1 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse skeletal muscle tissue, mouse cerebellum tissue, rat brain tissue, pig brain tissue Positive IHC detected in: human skeletal muscle tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26190 Product name: Recombinant human CACNA2D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-124 aa of NM_000722 Sequence: MEPFPSAVTIKSWVDKMQEDLVTLAKTASGVNQLVDIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLALEAEKVQAAHQWREDFASNEVVY Predict reactive species Full Name: calcium channel, voltage-dependent, alpha 2/delta subunit 1 Calculated Molecular Weight: 125 kDa Observed Molecular Weight: 125 kDa GenBank Accession Number: NM_000722 Gene Symbol: CACNA2D1 Gene ID (NCBI): 781 RRID: AB_2880874 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P54289 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.