Proteintech, 27456-1-AP, PLCB2 Polyclonal antibody

Size: 20ul / 150ul The PLCB2 (27456-1-AP) by Proteintech is a Polyclonal antibody targeting PLCB2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 27456-1-AP targets PLCB2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: THP-1 cells, HL-60 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PLCB2 (1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2) is also named as PLC-beta-2. PLCB2 is a critical regulator of platelet responses upon activation (PMID: 27465150). NF-κB regulates expression of PLC-β2. The PLCB2 genes was found to be differentially expressed in human breast cancer MCF-7 cells, and to be associated with multidrug resistance (PMID: 2951275). The knockdown of PLCB2 suppressed cell viability and promoted cell apoptosis by activating the Ras/Raf/MAPK pathway. Thus, PLCB2 may utilized as a potential therapeutic target in patients with melanoma (PMID: 31746389). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25771 Product name: Recombinant human PLCB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC000939 Sequence: MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLDITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLT Predict reactive species Full Name: phospholipase C, beta 2 Calculated Molecular Weight: 134 kDa Observed Molecular Weight: 134 kDa GenBank Accession Number: BC000939 Gene Symbol: PLCB2 Gene ID (NCBI): 5330 RRID: AB_3085963 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q00722 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.