Proteintech, 27457-1-AP, RRAS Polyclonal antibody

Size: 20ul / 150ul The RRAS (27457-1-AP) by Proteintech is a Polyclonal antibody targeting RRAS in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 27457-1-AP targets RRAS in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, PC-3 cells, HT-29 cells Positive IP detected in: HT-29 cells Positive IHC detected in: human renal cell carcinoma tissue, mouse kidney tissue, mouse colon tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:400-1:1600 Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26538 Product name: Recombinant human RRAS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-218 aa of BC016318 Sequence: DLESQRQVPRSEASAFGASHHVAYFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPSPPSAPRKKGGGCPCVLL Predict reactive species Full Name: related RAS viral (r-ras) oncogene homolog Calculated Molecular Weight: 218 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC016318 Gene Symbol: RRAS Gene ID (NCBI): 6237 RRID: AB_2880876 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10301 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.