Iright
BRAND / VENDOR: Proteintech

Proteintech, 27465-1-AP, HMGB3 Polyclonal antibody

CATALOG NUMBER: 27465-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The HMGB3 (27465-1-AP) by Proteintech is a Polyclonal antibody targeting HMGB3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 27465-1-AP targets HMGB3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: BGC-823 cells, MCF-7 cells, SGC-7901 cells, human placenta tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HMGB3, also named HMG2A and HMG4, belongs to the HMGB family. HMGB3 binds to nucleosomes in a sequence-independent manner and participates in DNA repair, replication, transcription, and recombination. HMGB3 is highly expressed in stem cells and cancer cells and is rarely transactivated in normal adult tissues, making it a promising therapeutic target. Overexpressed HMGB3 is closely related to tumor occurrence and reduced survival in cervical cancer, non-small-cell lung cancer, breast cancer, bladder cancer, hepatocellular carcnoma, colorectal cancer, gastric cancer, and leukemia (PMID: 35332131). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26361 Product name: Recombinant human HMGB3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC070482 Sequence: MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLF Predict reactive species Full Name: high-mobility group box 3 Calculated Molecular Weight: 200 aa, 23 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC070482 Gene Symbol: HMGB3 Gene ID (NCBI): 3149 RRID: AB_2880878 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15347 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924