Iright
BRAND / VENDOR: Proteintech

Proteintech, 27467-1-AP, ATG4A Polyclonal antibody

CATALOG NUMBER: 27467-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ATG4A (27467-1-AP) by Proteintech is a Polyclonal antibody targeting ATG4A in WB, IHC, ELISA applications with reactivity to human samples 27467-1-AP targets ATG4A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, MKN-45 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1500 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ATG4, a member of the cysteine protease family, plays an important role in autophagy induction. ATG4 enzymes cleave the C-terminal amino acid of ATG8 family proteins to reveal a C-terminal glycine that is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes. ATG4A, which may be a target for cancer prevention and intervention, has been reported to be related to breast tumorigenesis, lung cancer, ovarian cancer, cervical cancer and gastric cancer. (PMID: 27276686, 29435029, 28636635) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26497 Product name: Recombinant human ATG4A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-247 aa of BC061696 Sequence: DEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKEC Predict reactive species Full Name: ATG4 autophagy related 4 homolog A (S. cerevisiae) Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC061696 Gene Symbol: ATG4A Gene ID (NCBI): 115201 RRID: AB_2880879 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WYN0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924