Proteintech, 27478-1-AP, C1orf77 Polyclonal antibody

Size: 20ul / 150ul The C1orf77 (27478-1-AP) by Proteintech is a Polyclonal antibody targeting C1orf77 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 27478-1-AP targets C1orf77 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26580 Product name: Recombinant human C1orf77 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC002733 Sequence: MSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND Predict reactive species Full Name: chromosome 1 open reading frame 77 Calculated Molecular Weight: 248 aa, 26 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC002733 Gene Symbol: C1orf77 Gene ID (NCBI): 26097 RRID: AB_3085964 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3Y2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.