Proteintech, 27489-1-AP, TMX1 Polyclonal antibody

Size: 20ul / 150ul The TMX1 (27489-1-AP) by Proteintech is a Polyclonal antibody targeting TMX1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27489-1-AP targets TMX1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, mouse brain tissue, HeLa cells, Jurkat cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information TMX1, one of the few transmembrane members of the family, is the first vascular thiol isomerase with antithrombotic function. It forms functional complexes with the ER lectin calnexin and preferentially intervenes during maturation of cysteine-containing, membrane-associated proteins while ignoring the same cysteine-containing ectodomains if not anchored at the ER membrane. As such, TMX1 is the first example of a topology-specific client protein redox catalyst in living cells(PMID: 30655304). Covalent modification with AMS increases the molecular mass of originally oxidized species by ~0.5 kDa per thiol group, which allows enhanced separation from the reduced form in electrophoresis(PMID: 29123984). TMX1 has 2 bands produces by redox with the MW of 30-32 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26595 Product name: Recombinant human TMX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 202-280 aa of BC036460 Sequence: VADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS Predict reactive species Full Name: thioredoxin-related transmembrane protein 1 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC036460 Gene Symbol: TMX1 Gene ID (NCBI): 81542 RRID: AB_2880886 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3N1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.