Proteintech, 27497-1-AP, Reticulocalbin 3 Polyclonal antibody

Size: 20ul / 150ul The Reticulocalbin 3 (27497-1-AP) by Proteintech is a Polyclonal antibody targeting Reticulocalbin 3 in WB, ELISA applications with reactivity to Human samples 27497-1-AP targets Reticulocalbin 3 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26569 Product name: Recombinant human RCN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 71-161 aa of BC013436 Sequence: LTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETY Predict reactive species Full Name: reticulocalbin 3, EF-hand calcium binding domain Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC013436 Gene Symbol: Reticulocalbin 3 Gene ID (NCBI): 57333 RRID: AB_2880890 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96D15 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.