Proteintech, 27499-1-AP, SLC31A1 Polyclonal antibody

Size: 20ul / 150ul The SLC31A1 (27499-1-AP) by Proteintech is a Polyclonal antibody targeting SLC31A1 in WB, IF-P, FC, ELISA applications with reactivity to human, mouse samples 27499-1-AP targets SLC31A1 in WB, IHC, IF-P, FC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HT-29 cells, Caco-2 cells, HeLa cells Positive IF-P detected in: human liver cancer tissue Positive FC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Flow Cytometry (FC): FC : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SLC31A1, also known as CTR1, COPT1 and solute carrier family 31 member 1, is a high-affinity copper transporter found in the cell membrane of human cells. It plays a crucial role in maintaining copper homeostasis within the body and functions as a homotrimer to influence dietary copper absorption in the cell membrane (PMID: 37853210; 28507097). SLC31A1 has three putative transmembrane domains, with an N-terminus located extracellularly and a C-terminus located intracellularly (PMID: 12827356). SLC31A1 can be detected a a 28 kDa band corresponding to glycosylated hCTR1 monomer, and a 24 kDa band that is unglycosylated hCTR1. In some membrane preparations a C-terminal degradation product of 17 kDa is also seen (PMID: 16135512). Additionally, SLC31A1 may also resolve as a 30 to 35 kDa and a 60 to 70 kDa protein on immunoblots, forming oligomers corresponding to the expected size of a homotrimeric complex (PMID: 12827356). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26601 Product name: Recombinant human SLC31A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species Full Name: solute carrier family 31 (copper transporters), member 1 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21-25,30-35,60-70 kDa GenBank Accession Number: BC013611 Gene Symbol: SLC31A1 Gene ID (NCBI): 1317 RRID: AB_2918124 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15431 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.