Proteintech, 27514-1-AP, LARP6 Polyclonal antibody

Size: 20ul / 150ul The LARP6 (27514-1-AP) by Proteintech is a Polyclonal antibody targeting LARP6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 27514-1-AP targets LARP6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse brain tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information La-related protein 6 (LARP6), also known as Acheron or La ribonucleoprotein domain family member 6, is a protein encoded by the LARP6 gene in humans. It is a member of the LARP superfamily of RNA-binding proteins, which are post-transcriptional regulators. It is a phosphoprotein and eight phosphorylation sites have been identified. Six of these phosphorylation sites reside in the C-terminal domain of LARP6 (CTER). These sites are Ser348, Ser396, Ser409, Ser421, Ser447, and Ser451 (PMID: 27011170). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24354 Product name: Recombinant human LARP6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 378-491 aa of BC009446 Sequence: CTSPWSSPLAQRKGVSRKSPLAEEGRLNCSTSPEIFRKCMDYSSDSSVTPSGSPWVRRRRQAEMGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRACV Predict reactive species Full Name: La ribonucleoprotein domain family, member 6 Calculated Molecular Weight: 491 aa, 55 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC009446 Gene Symbol: LARP6 Gene ID (NCBI): 55323 RRID: AB_3669606 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRS8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.