Product Description
Size: 20ul / 150ul
The LARP6 (27514-1-AP) by Proteintech is a Polyclonal antibody targeting LARP6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
27514-1-AP targets LARP6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: Jurkat cells, mouse brain tissue
Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
La-related protein 6 (LARP6), also known as Acheron or La ribonucleoprotein domain family member 6, is a protein encoded by the LARP6 gene in humans. It is a member of the LARP superfamily of RNA-binding proteins, which are post-transcriptional regulators. It is a phosphoprotein and eight phosphorylation sites have been identified. Six of these phosphorylation sites reside in the C-terminal domain of LARP6 (CTER). These sites are Ser348, Ser396, Ser409, Ser421, Ser447, and Ser451 (PMID: 27011170).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag24354 Product name: Recombinant human LARP6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 378-491 aa of BC009446 Sequence: CTSPWSSPLAQRKGVSRKSPLAEEGRLNCSTSPEIFRKCMDYSSDSSVTPSGSPWVRRRRQAEMGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRACV Predict reactive species
Full Name: La ribonucleoprotein domain family, member 6
Calculated Molecular Weight: 491 aa, 55 kDa
Observed Molecular Weight: 70 kDa
GenBank Accession Number: BC009446
Gene Symbol: LARP6
Gene ID (NCBI): 55323
RRID: AB_3669606
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9BRS8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924