Proteintech, 27524-1-AP, Supervillin Polyclonal antibody

Size: 20ul / 150ul The Supervillin (27524-1-AP) by Proteintech is a Polyclonal antibody targeting Supervillin in WB, IHC, ELISA applications with reactivity to human, mouse samples 27524-1-AP targets Supervillin in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells Positive IHC detected in: mouse skeletal muscle tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Supervillin (SVIL) belongs to the villin/gelsolin superfamily of actin-binding proteins involved in many cellular processes. A non-muscle-specific form of Supervillin activates androgen receptor activity. Supervillin another isoform, called Archvillin, is expressed in skeletal and cardiac muscle tissue where it plays a role in both muscle fiber structure and signaling. Mutations in Supervillin are associated with myofibrillar Myopathy10 (MFM10), which causes myopathy with myofibrillar disorganization and autophagic vacuoles(PMID: 9867483, 32779703). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26196 Product name: Recombinant human Supervillin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1679-1787 aa of NM_003174 Sequence: MFLDWTELKRSNEKNPGELAQHKEDPRTDVKAYDVTRMVSMPQTTAGTILDGVNVGRGYGLVEGHDRRQFEITSVSVDVWHILEFDYSRLPKQSIGQFHEGDAYVVKWKF Predict reactive species Full Name: supervillin Calculated Molecular Weight: 248 kDa Observed Molecular Weight: 205 kDa GenBank Accession Number: NM_003174 Gene Symbol: SVIL Gene ID (NCBI): 6840 RRID: AB_3669607 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95425 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.