Iright
BRAND / VENDOR: Proteintech

Proteintech, 27525-1-AP, BEX4 Polyclonal antibody

CATALOG NUMBER: 27525-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The BEX4 (27525-1-AP) by Proteintech is a Polyclonal antibody targeting BEX4 in WB, ELISA applications with reactivity to human samples 27525-1-AP targets BEX4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information BEX4, also known as BEXL1 and NADE3, which belongs to the BEX family. The brain-expressed X-linked (BEX) family consists of five member genes (from 1 to 5) that are commonly located on the X chromosome. The molecular weight of BEXs is approximately 15 kDa, but little is known about their structural characteristics and molecular functions (PMID: 34576008). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag26207 Product name: Recombinant human BEX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC015794 Sequence: MESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPNFRWAIPNRHIEHNEARDDVERFVGQMMEIKRKTREQQMRHYMRFQTPEPDNHYDFCLIP Predict reactive species Full Name: brain expressed, X-linked 4 Calculated Molecular Weight: 120 aa, 14 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC015794 Gene Symbol: BEX4 Gene ID (NCBI): 56271 RRID: AB_3669608 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NWD9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924