Proteintech, 27534-1-AP, TMEM45A Polyclonal antibody

Size: 20ul / 150ul The TMEM45A (27534-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM45A in WB, ELISA applications with reactivity to human samples 27534-1-AP targets TMEM45A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A-253 cells, A431 cells, MDA-MB-231 cells, SKOV-3 cells, HH cells, HFF cells, HaCaT cells, MJ cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information TMEM45A, also known as DERP7, DNAPTP4, or FLJ10134, is a transmembrane protein belonging to the TMEM family. TMEM45A is highly expressed in keratinocytes and its expression correlates with keratinization, suggesting a role in normal epidermal physiology(PMID: 22954140; PMID: 24689342). TMEM45A promotes cell proliferation, migration, and invasion in glioblastoma cells, favors epithelial-mesenchymal transition (EMT) in colorectal cancer and promotes cell proliferation by favoring the G1/S cell cycle transition in ovarian cancer cells (PMID: 37936608). The predicted molecular weight of TMEM45A is 32 kDa, and 66-98 kDa has been reported in the literature(PMID: 22954140). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag24392 Product name: Recombinant human TMEM45A protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 229-275 aa of BC040355 Sequence: YAVTIVIVGMNYAFITWLVKSRLKRLCSSEVGLLKNAEREQESEEEM Predict reactive species Full Name: transmembrane protein 45A Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC040355 Gene Symbol: TMEM45A Gene ID (NCBI): 55076 RRID: AB_3669609 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NWC5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.