Product Description
Size: 20ul / 150ul
The Cathepsin S (27538-1-AP) by Proteintech is a Polyclonal antibody targeting Cathepsin S in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
27538-1-AP targets Cathepsin S in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HUVEC cells, THP-1 cells, U-87 MG cells
Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: U-87 MG cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
Cathepsin S (CTSS) is a cysteine protease that plays an important role in extracellular matrix degradation and remodeling, antigen presentation, inflammation, and angiogenesis; it has been identified as a radiation response gene. In malignant tumors, CTSS induces tumor proliferation, invasion and metastasis through various mechanisms. CTSS proteins could be detected in two forms, pro-CTSS (35-37 kDa) and active CTSS (25 kDa) (PMID: 30006610, PMID: 34208434). And in this publication, it was also reporeted that active CTSS was expressed at higher levels than pro-CTSS in the lysate (PMID: 34208434).
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag25881 Product name: Recombinant human CTSS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 179-296 aa of BC002642 Sequence: GCNGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLV Predict reactive species
Full Name: cathepsin S
Calculated Molecular Weight: 37 kDa
Observed Molecular Weight: 25 kDa, 37 kDa
GenBank Accession Number: BC002642
Gene Symbol: CTSS
Gene ID (NCBI): 1520
RRID: AB_3085966
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P25774
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924