Iright
BRAND / VENDOR: Proteintech

Proteintech, 27554-1-AP, AKD2 Polyclonal antibody

CATALOG NUMBER: 27554-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The AKD2 (27554-1-AP) by Proteintech is a Polyclonal antibody targeting AKD2 in WB, IHC, ELISA applications with reactivity to human samples 27554-1-AP targets AKD2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SMMC-7721 cells, HepG2 cells, HuH-7 cells Positive IHC detected in: human heart tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information AK9, also named as adenylate kinase 9, belongs to adenylate kinase family, which is a small, ususlly monomeric, enzyme found in every living thing due to its crucial role in energenic metabolism(PMID: 30666486). AK9 is a nucleoside mono- and diphosphate kinase due to its broad phosphatase activity, the local concentration of substrates probably influences catalytic activity(PMID: 24495878). This antibody can detect 45-50 kDa band of AK9(PMID: 23416111). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag25805 Product name: Recombinant human AKD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-421 aa of BC022031 Sequence: MTSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYITQAWKCIRVEALPILEEQIAAETESGVMLQSMLISGQSIPDELVIKLMLEKLNSPEVCHFGYIITEIPSLSQDAMTTLQQIELIKNLNLKPDVIINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEVIENHRKKKKEAQKDGKGEEEEEEEEQEEEEAFIAEMQMVAEILHHLVQRPEDYLENVENIVKLYKETILQTLEEVMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKLQGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN Predict reactive species Full Name: adenylate kinase domain containing 2 Calculated Molecular Weight: 221 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC022031 Gene Symbol: AKD2 Gene ID (NCBI): 221264 RRID: AB_2880904 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5TCS8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924