Product Description
Size: 20ul / 150ul
The Alpha Taxilin (27558-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha Taxilin in WB, IHC, ELISA applications with reactivity to human samples
27558-1-AP targets Alpha Taxilin in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells
Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Background Information
Alpha-taxilin is a member of the taxilin family which consist of at least three members: alpha-, beta- and gamma-taxilins. Alpha-taxilin was identified as a novel binding partner of the syntaxin family, which is involved in intracellular vesicle traffic. Alpha-taxilin is ubiquitously expressed. It plays an essential role for release of HBV-DNA containing particles. Alpha-taxilin encompasses 546 aa and has a calculated molecular weight of 62 kDa. It migrates on SDS-PAGE with an apparent molecular weight of 75 kDa. (PMID: 12558796; 23816704)
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag23001 Product name: Recombinant human TXLNA protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 477-546 aa of BC103823 Sequence: ERNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQEPTSARA Predict reactive species
Full Name: taxilin alpha
Calculated Molecular Weight: 546 aa, 62 kDa
Observed Molecular Weight: 75 kDa
GenBank Accession Number: BC103823
Gene Symbol: Alpha Taxilin
Gene ID (NCBI): 200081
RRID: AB_2880907
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P40222
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924