Iright
BRAND / VENDOR: Proteintech

Proteintech, 27558-1-AP, Alpha Taxilin Polyclonal antibody

CATALOG NUMBER: 27558-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Alpha Taxilin (27558-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha Taxilin in WB, IHC, ELISA applications with reactivity to human samples 27558-1-AP targets Alpha Taxilin in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Alpha-taxilin is a member of the taxilin family which consist of at least three members: alpha-, beta- and gamma-taxilins. Alpha-taxilin was identified as a novel binding partner of the syntaxin family, which is involved in intracellular vesicle traffic. Alpha-taxilin is ubiquitously expressed. It plays an essential role for release of HBV-DNA containing particles. Alpha-taxilin encompasses 546 aa and has a calculated molecular weight of 62 kDa. It migrates on SDS-PAGE with an apparent molecular weight of 75 kDa. (PMID: 12558796; 23816704) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag23001 Product name: Recombinant human TXLNA protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 477-546 aa of BC103823 Sequence: ERNDLNKRVQDLSAGGQGSLTDSGPERRPEGPGAQAPSSPRVTEAPCYPGAPSTEASGQTGPQEPTSARA Predict reactive species Full Name: taxilin alpha Calculated Molecular Weight: 546 aa, 62 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC103823 Gene Symbol: Alpha Taxilin Gene ID (NCBI): 200081 RRID: AB_2880907 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40222 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924